CX6B1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CX6B1_ARATH
• UniProt AC: Q9S7L9
• Protein Name: Cytochrome c oxidase subunit 6b-1
• Gene Name: COX6B-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 191
• Subcellular Localization: Mitochondrion.
• Protein Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. This protein may be one of the heme-binding subunits of the oxidase..
• Protein Sequence: MADAVNAQTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKEESPVEEAVSVVEEKSESAPESTEVASEAPAAAEDNAEETPAAAEENNDENASEEVAEETPDEIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRENGTFPGPLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADAVNAQT ------CCCCCCCCC	17.30	22223895
23	Acetylation	YHLEKEVKQDTSAKP HHHHHHHCCCCCCCC	43.48	24727099
160	Acetylation	DDAPECDKFAKFYRS CCCHHHHHHHHHHHH	59.90	24727099

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CX6B1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CX6B1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CX6B1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CX6B1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.