UniProt ID | CX6B1_ARATH | |
---|---|---|
UniProt AC | Q9S7L9 | |
Protein Name | Cytochrome c oxidase subunit 6b-1 | |
Gene Name | COX6B-1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 191 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. This protein may be one of the heme-binding subunits of the oxidase.. | |
Protein Sequence | MADAVNAQTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKEESPVEEAVSVVEEKSESAPESTEVASEAPAAAEDNAEETPAAAEENNDENASEEVAEETPDEIKLETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWNEQRENGTFPGPLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADAVNAQT ------CCCCCCCCC | 17.30 | 22223895 | |
23 | Acetylation | YHLEKEVKQDTSAKP HHHHHHHCCCCCCCC | 43.48 | 24727099 | |
160 | Acetylation | DDAPECDKFAKFYRS CCCHHHHHHHHHHHH | 59.90 | 24727099 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CX6B1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CX6B1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CX6B1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CX6B1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...