CX6A1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CX6A1_MOUSE
• UniProt AC: P43024
• Protein Name: Cytochrome c oxidase subunit 6A1, mitochondrial
• Gene Name: Cox6a1
• Organism: Mus musculus (Mouse).
• Sequence Length: 111
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport..
• Protein Sequence: MASAVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	PGLRRPMSSGAHGEE CCCCCCCCCCCCCCC	28.44	29899451
28	Phosphorylation	GLRRPMSSGAHGEEG CCCCCCCCCCCCCCH	33.47	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CX6A1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CX6A1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CX6A1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CX6A1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.