CX5B1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CX5B1_ARATH
• UniProt AC: Q9LW15
• Protein Name: Cytochrome c oxidase subunit 5b-1, mitochondrial
• Gene Name: COX5B-1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 176
• Subcellular Localization: Mitochondrion inner membrane .
• Protein Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport..
• Protein Sequence: MWRRIVSSQLKTLAADVVAASPRRSIAATTRPVGFYLAANRSAISASSFVIPRRFSSDSVETPATKKVEDVMPIATGHEKEELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGPGGPPDGHGDEDDEHHH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	AADVVAASPRRSIAA HHHHHHCCCCCCCCC	14.81	23111157
56	Phosphorylation	FVIPRRFSSDSVETP EEEECCCCCCCCCCC	31.27	23111157
57	Phosphorylation	VIPRRFSSDSVETPA EEECCCCCCCCCCCC	31.06	28295753
59	Phosphorylation	PRRFSSDSVETPATK ECCCCCCCCCCCCCC	24.65	28295753
72	Sulfoxidation	TKKVEDVMPIATGHE CCCHHHCEECCCCCC	2.84	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CX5B1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CX5B1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CX5B1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CX5B1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.