UniProt ID | CWF20_SCHPO | |
---|---|---|
UniProt AC | Q9USK4 | |
Protein Name | Pre-mRNA-splicing factor cwf20 | |
Gene Name | cwf20 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 290 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome.. | |
Protein Sequence | MSLVSYPRSESESDIEEETPLASKSFDPTLFQHARRKLSVDSTKKSPKRLKRQVDLQKSSFNDKTFNESDVISNERFKSNDLLELLPAPKNQAELAPKSSKRSDLDLNENYLLPNNSVSDLTSTGSSETVKKSTYSEKSGNVSLFNIVGSESKQASLVDSDQKPYQPILIKPKARANPPKLRNQPENDFISIANHSVHSNAEDINIINEDYIEIGRHRKEKGRIIDVDINKLPKPTQEALPSAPTIKSVAPGRHQLSSLVEMAISQKDNFEAYFEQQRSNKKASSQKYGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MSLVSYPRSESES --CCCCCCCCCCCCC | 8.66 | 21712547 | |
9 | Phosphorylation | SLVSYPRSESESDIE CCCCCCCCCCCCCCC | 40.76 | 25720772 | |
11 | Phosphorylation | VSYPRSESESDIEEE CCCCCCCCCCCCCCC | 43.58 | 21712547 | |
13 | Phosphorylation | YPRSESESDIEEETP CCCCCCCCCCCCCCC | 53.84 | 24763107 | |
19 | Phosphorylation | ESDIEEETPLASKSF CCCCCCCCCCCCCCC | 27.21 | 24763107 | |
79 | Phosphorylation | ISNERFKSNDLLELL CCCHHHHCCCHHHHC | 32.63 | 25720772 | |
117 | Phosphorylation | NYLLPNNSVSDLTST CEECCCCCHHHCCCC | 29.64 | 21712547 | |
122 | Phosphorylation | NNSVSDLTSTGSSET CCCHHHCCCCCCCCC | 29.27 | 21712547 | |
123 | Phosphorylation | NSVSDLTSTGSSETV CCHHHCCCCCCCCCC | 37.76 | 21712547 | |
279 | Phosphorylation | AYFEQQRSNKKASSQ HHHHHHHHCCCHHHH | 48.97 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWF20_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWF20_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWF20_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IDHP_SCHPO | idp1 | genetic | 22681890 | |
COQ5_SCHPO | coq5 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...