| UniProt ID | CWF20_SCHPO | |
|---|---|---|
| UniProt AC | Q9USK4 | |
| Protein Name | Pre-mRNA-splicing factor cwf20 | |
| Gene Name | cwf20 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 290 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome.. | |
| Protein Sequence | MSLVSYPRSESESDIEEETPLASKSFDPTLFQHARRKLSVDSTKKSPKRLKRQVDLQKSSFNDKTFNESDVISNERFKSNDLLELLPAPKNQAELAPKSSKRSDLDLNENYLLPNNSVSDLTSTGSSETVKKSTYSEKSGNVSLFNIVGSESKQASLVDSDQKPYQPILIKPKARANPPKLRNQPENDFISIANHSVHSNAEDINIINEDYIEIGRHRKEKGRIIDVDINKLPKPTQEALPSAPTIKSVAPGRHQLSSLVEMAISQKDNFEAYFEQQRSNKKASSQKYGF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MSLVSYPRSESES --CCCCCCCCCCCCC | 8.66 | 21712547 | |
| 9 | Phosphorylation | SLVSYPRSESESDIE CCCCCCCCCCCCCCC | 40.76 | 25720772 | |
| 11 | Phosphorylation | VSYPRSESESDIEEE CCCCCCCCCCCCCCC | 43.58 | 21712547 | |
| 13 | Phosphorylation | YPRSESESDIEEETP CCCCCCCCCCCCCCC | 53.84 | 24763107 | |
| 19 | Phosphorylation | ESDIEEETPLASKSF CCCCCCCCCCCCCCC | 27.21 | 24763107 | |
| 79 | Phosphorylation | ISNERFKSNDLLELL CCCHHHHCCCHHHHC | 32.63 | 25720772 | |
| 117 | Phosphorylation | NYLLPNNSVSDLTST CEECCCCCHHHCCCC | 29.64 | 21712547 | |
| 122 | Phosphorylation | NNSVSDLTSTGSSET CCCHHHCCCCCCCCC | 29.27 | 21712547 | |
| 123 | Phosphorylation | NSVSDLTSTGSSETV CCHHHCCCCCCCCCC | 37.76 | 21712547 | |
| 279 | Phosphorylation | AYFEQQRSNKKASSQ HHHHHHHHCCCHHHH | 48.97 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWF20_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWF20_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWF20_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IDHP_SCHPO | idp1 | genetic | 22681890 | |
| COQ5_SCHPO | coq5 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
