UniProt ID | CUT1A_ARATH | |
---|---|---|
UniProt AC | O04616 | |
Protein Name | Protein CURVATURE THYLAKOID 1A, chloroplastic | |
Gene Name | CURT1A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 164 | |
Subcellular Localization |
Plastid, chloroplast, plastoglobule . Membrane Multi-pass membrane protein . Plastid, chloroplast thylakoid membrane Multi-pass membrane protein. Located almost exclusively at grana margins. |
|
Protein Description | Determines thylakoid architecture by inducing membrane curvature.. | |
Protein Sequence | MAISVAASSSMAVMVPRVPAVSTRCSAVPYLPPRSFGRSSFTVPLKLVSGNGLQKVELLKTRASSEETSSIDTNELITDLKEKWDGLENKSTVLIYGGGAIVAVWLSSIVVGAINSVPLLPKVMELVGLGYTGWFVYRYLLFKSSRKELAEDIESLKKKIAGSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Acetylation | VELLKTRASSEETSS EEEEECCCCCCCCCC | 22223895 | ||
64 | Phosphorylation | ELLKTRASSEETSSI EEEECCCCCCCCCCC | 30407730 | ||
65 | Phosphorylation | LLKTRASSEETSSID EEECCCCCCCCCCCC | 30407730 | ||
68 | Phosphorylation | TRASSEETSSIDTNE CCCCCCCCCCCCHHH | 30407730 | ||
69 | Phosphorylation | RASSEETSSIDTNEL CCCCCCCCCCCHHHH | 30407730 | ||
70 | Phosphorylation | ASSEETSSIDTNELI CCCCCCCCCCHHHHH | 30407730 | ||
73 | Phosphorylation | EETSSIDTNELITDL CCCCCCCHHHHHHHH | 30407730 | ||
78 | Phosphorylation | IDTNELITDLKEKWD CCHHHHHHHHHHHCC | 19376835 | ||
139 | Nitration | TGWFVYRYLLFKSSR HHHHHHHHHHHHHHH | - | ||
155 | Phosphorylation | ELAEDIESLKKKIAG HHHHHHHHHHHHHCC | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CUT1A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CUT1A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CUT1A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CUT1A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...