CU058_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CU058_HUMAN
• UniProt AC: P58505
• Protein Name: Uncharacterized protein C21orf58
• Gene Name: C21orf58
• Organism: Homo sapiens (Human).
• Sequence Length: 322
• Protein Sequence: MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLWPPLPLQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLHLEPGNEDRPDDALQTALKRRRDLLQRLREQHLLDELSRAQAWSGPSRGALGSALPPELPPTGILPTASPSPLAPDPPRIILPTVPQPPATIIQQLPQQPLIAQIPPPQAFPTQRSGSIKEDMVELLLLQNAQVHQLVLQNWMLKALPPALQDPPHVPPRVPRAARPRLPAVHHHHHHHHAVWPPGAATVLQPAPSLWTPGPP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
157	Phosphorylation	QHLLDELSRAQAWSG HHHHHHHHHHHHHCC	24.42	24719451
163	Phosphorylation	LSRAQAWSGPSRGAL HHHHHHHCCCCCCCC	43.79	24719451
166	Phosphorylation	AQAWSGPSRGALGSA HHHHCCCCCCCCCCC	47.04	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CU058_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CU058_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CU058_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CU058_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.