dbPTM

CTU1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CTU1_ARATH
UniProt AC	O64862
Protein Name	Cytoplasmic tRNA 2-thiolation protein 1 {ECO:0000255\|HAMAP-Rule:MF_03053}
Gene Name	NCS6 {ECO:0000255\|HAMAP-Rule:MF_03053}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	355
Subcellular Localization	Cytoplasm .
Protein Description	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position..
Protein Sequence	MEAKNKKAVASRLCCLCNLRRPVLKRPKTLQQICRECFYEVFEEEIHQVIVQNRLFKSGERVAIGASGGKDSTVLAYVLSELNRRHNYGLDLFLLSIDEGITGYRDDSLETVKRNEVQYGLPLKIVSYKDLYGWTMDEIVKMIGLKNNCTFCGVFRRQALDRGAALLKVEKLVTGHNADDIAETVLLNILRGDIARLSRCTSITTGEDGPIPRCKPFKYTYEKEIVMYAYFKKLDYFSTECIYSPNAYRGFAREFIKDLERIRPRAILDIIKSGEDFRIATTTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIGRPRGVNGDHNKETKKPGSVAKSIESKQCGSLDF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
58	Phosphorylation	VQNRLFKSGERVAIG HHCCCCCCCCEEEEE	38.25	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CTU1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CTU1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CTU1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CTU1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CTU1_ARATH

Related Literatures of Post-Translational Modification