UniProt ID | CTHR1_HUMAN | |
---|---|---|
UniProt AC | Q96CG8 | |
Protein Name | Collagen triple helix repeat-containing protein 1 | |
Gene Name | CTHRC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | May act as a negative regulator of collagen matrix deposition.. | |
Protein Sequence | MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
97 | Phosphorylation | KGECLRESFEESWTP CCHHHHHHHHHCCCC | 31.37 | 28348404 | |
186 | N-linked_Glycosylation | DQGSPEMNSTINIHR CCCCCCCCCEEEEEE | 34.05 | UniProtKB CARBOHYD | |
187 | Phosphorylation | QGSPEMNSTINIHRT CCCCCCCCEEEEEEC | 29.38 | 29759185 | |
196 | Phosphorylation | INIHRTSSVEGLCEG EEEEECCCHHHHHCC | 24.47 | 29759185 | |
228 | Phosphorylation | YPKGDASTGWNSVSR CCCCCCCCCCCCEEE | 48.19 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CTHR1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CTHR1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CTHR1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CTHR1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...