| UniProt ID | CTF8_MOUSE | |
|---|---|---|
| UniProt AC | P0CG15 | |
| Protein Name | Chromosome transmission fidelity protein 8 homolog | |
| Gene Name | Chtf8 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 121 | |
| Subcellular Localization | Nucleus. Associates with chromatin during S phase.. | |
| Protein Description | Chromosome cohesion factor involved in sister chromatid cohesion and fidelity of chromosome transmission. Component of one of the cell nuclear antigen loader complexes, CTF18-replication factor C (CTF18-RFC), which consists of CTF18, CTF8, DCC1, RFC2, RFC3, RFC4 and RFC5. The CTF18-RFC complex binds to single-stranded and primed DNAs and has weak ATPase activity that is stimulated the presence of primed DNA, replication protein A (RPA) and proliferating cell nuclear antigen (PCNA). The CTF18-RFC complex catalyzes the ATP-dependent loading of PCNA onto primed and gapped DNA. It also interacts with and stimulates POLH, which is suggestive of a protein network that coordinates DNA repair, recombination and chromosome cohesion reactions with replication fork progression (By similarity).. | |
| Protein Sequence | MVQIVISSTGAEGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKTIHLEKPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKPIITNVPKKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MVQIVISSTGAEGL -CCEEEEECCCHHHH | 15.79 | - | |
| 8 | Phosphorylation | MVQIVISSTGAEGLA CCEEEEECCCHHHHH | 21.53 | - | |
| 9 | Phosphorylation | VQIVISSTGAEGLAE CEEEEECCCHHHHHH | 33.35 | - | |
| 97 | Phosphorylation | TGTQYLVTALIKNKI CCHHHHHHHHHHCCC | 17.10 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CTF8_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CTF8_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CTF8_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CTF8_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
