CTDS1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CTDS1_MOUSE
• UniProt AC: P58466
• Protein Name: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
• Gene Name: Ctdsp1
• Organism: Mus musculus (Mouse).
• Sequence Length: 261
• Subcellular Localization: Nucleus.
• Protein Description: Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation (By similarity). Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells..
• Protein Sequence: MDSSAVITQISKEEARGPLRGKGDQKSAVSQKPRSRGILHSLFCCVCRDDGEPLPAHSGAPLLVEENGAIPKHTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDSSAVIT -------CCCCCEEE	11.56	-
3	Phosphorylation	-----MDSSAVITQI -----CCCCCEEEEC	20.92	28066266
4	Phosphorylation	----MDSSAVITQIS ----CCCCCEEEECC	23.45	28066266
8	Phosphorylation	MDSSAVITQISKEEA CCCCCEEEECCHHHH	17.16	28066266
11	Phosphorylation	SAVITQISKEEARGP CCEEEECCHHHHCCC	24.97	23984901
78	Phosphorylation	PKHTPVQYLLPEAKA CCCCCHHHHCCHHHC	15.50	29514104
84	Ubiquitination	QYLLPEAKAQDSDKI HHHCCHHHCCCCCCE	44.94	22790023
188	Phosphorylation	CVFHRGNYVKDLSRL CCEECCCHHHHHHHH	16.23	27742792
251	Phosphorylation	LSRVDDVYSVLRQPR HCCCCHHHHHHCCCC	10.47	29514104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CTDS1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CTDS1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CTDS1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CTDS1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.