| UniProt ID | CTAG2_HUMAN | |
|---|---|---|
| UniProt AC | O75638 | |
| Protein Name | Cancer/testis antigen 2 | |
| Gene Name | CTAG2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 210 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MQAEGQGTGGSTGDA CCCCCCCCCCCCCCC | 30.40 | 24114839 | |
| 11 | Phosphorylation | EGQGTGGSTGDADGP CCCCCCCCCCCCCCC | 30.48 | 24114839 | |
| 12 | Phosphorylation | GQGTGGSTGDADGPG CCCCCCCCCCCCCCC | 42.21 | 24114839 | |
| 57 | Methylation | AARASGPRGGAPRGP CCCCCCCCCCCCCCC | 60.75 | - | |
| 124 | Ubiquitination | PRPGAVLKDFTVSGN CCCCCEEEEEEEECC | 44.17 | 21963094 | |
| 124 (in isoform 2) | Ubiquitination | - | 44.17 | 21906983 | |
| 157 | Phosphorylation | VVGWGLGSASPEGQK EEEECCCCCCCCCHH | 30.53 | 20068231 | |
| 159 | Phosphorylation | GWGLGSASPEGQKAR EECCCCCCCCCHHHH | 25.77 | 20068231 | |
| 164 | Acetylation | SASPEGQKARDLRTP CCCCCCHHHHHCCCC | 57.13 | 24468019 | |
| 164 | Ubiquitination | SASPEGQKARDLRTP CCCCCCHHHHHCCCC | 57.13 | 21963094 | |
| 172 | Ubiquitination | ARDLRTPKHKVSEQR HHHCCCCCCCCCCCC | 56.28 | 22817900 | |
| 174 | Ubiquitination | DLRTPKHKVSEQRPG HCCCCCCCCCCCCCC | 54.29 | 21963094 | |
| 182 | Phosphorylation | VSEQRPGTPGPPPPE CCCCCCCCCCCCCCC | 27.96 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CTAG2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CTAG2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CTAG2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CTAG2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
