| UniProt ID | CSRP2_MOUSE | |
|---|---|---|
| UniProt AC | P97314 | |
| Protein Name | Cysteine and glycine-rich protein 2 | |
| Gene Name | Csrp2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 193 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system (By similarity).. | |
| Protein Sequence | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | S-nitrosocysteine | YHAEEVQCDGRSFHR EEEEEEECCCCCHHH | 7.86 | - | |
| 25 | S-nitrosylation | YHAEEVQCDGRSFHR EEEEEEECCCCCHHH | 7.86 | 21278135 | |
| 57 | Phosphorylation | AIHDEEIYCKSCYGK EECCCEEEECCCCCC | 9.34 | 26060331 | |
| 69 | Ubiquitination | YGKKYGPKGYGYGQG CCCCCCCCCCCCCCC | 61.47 | - | |
| 71 | Phosphorylation | KKYGPKGYGYGQGAG CCCCCCCCCCCCCCC | 17.19 | 25195567 | |
| 73 | Phosphorylation | YGPKGYGYGQGAGTL CCCCCCCCCCCCCEE | 9.59 | 25195567 | |
| 79 | Phosphorylation | GYGQGAGTLNMDRGE CCCCCCCEECCCCCC | 17.90 | 29514104 | |
| 91 | Ubiquitination | RGERLGIKPESAQPH CCCCCCCCCCCCCCC | 40.72 | - | |
| 112 | Acetylation | NTSKFAQKYGGAEKC CHHHHHHHHCCCHHC | 42.29 | 23806337 | |
| 125 | Phosphorylation | KCSRCGDSVYAAEKI HCCCCCCHHHHHHHH | 11.43 | 23737553 | |
| 131 | Acetylation | DSVYAAEKIIGAGKP CHHHHHHHHHCCCCC | 34.59 | - | |
| 137 | Succinylation | EKIIGAGKPWHKNCF HHHHCCCCCCCCCCH | 44.38 | - | |
| 137 | Acetylation | EKIIGAGKPWHKNCF HHHHCCCCCCCCCCH | 44.38 | 23806337 | |
| 137 | Succinylation | EKIIGAGKPWHKNCF HHHHCCCCCCCCCCH | 44.38 | 23806337 | |
| 161 | Acetylation | ESTTLTEKEGEIYCK CCCCCCEECCEEEEC | 66.82 | - | |
| 173 | Acetylation | YCKGCYAKNFGPKGF EECCCEECCCCCCCC | 26.74 | 23806337 | |
| 182 | Phosphorylation | FGPKGFGYGQGAGAL CCCCCCCCCCCCCCE | 12.19 | 29514104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSRP2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSRP2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSRP2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CSRP2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...