CSPL7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSPL7_ARATH
• UniProt AC: Q8L924
• Protein Name: CASP-like protein 2B2
• Gene Name: At2g35760
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 201
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Sequence: MSYLGVGVSPGNVSGSTTKMKLIDRKVRVTELILRCLVCVLALVAAILIATDVQVREIFMIQKKAKFTDMKALVLLVVVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQAVAYLCVAGVAAAAQSAAFAKLGEPELQWMKICNMYGKFCNQVGEGIASALFACIGMVLISCISAFGVFRLYGGSKSRPSSRW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSYLGVGVS ------CCCCCCCCC	29.12	23776212
3	Phosphorylation	-----MSYLGVGVSP -----CCCCCCCCCC	13.23	23776212
9	Phosphorylation	SYLGVGVSPGNVSGS CCCCCCCCCCCCCCC	22.59	30291188
14	Phosphorylation	GVSPGNVSGSTTKMK CCCCCCCCCCCCHHH	30.90	23776212
16	Phosphorylation	SPGNVSGSTTKMKLI CCCCCCCCCCHHHHC	25.95	23776212
17	Phosphorylation	PGNVSGSTTKMKLID CCCCCCCCCHHHHCC	33.68	23776212
18	Phosphorylation	GNVSGSTTKMKLIDR CCCCCCCCHHHHCCC	30.73	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSPL7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSPL7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSPL7_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CSPL7_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.