dbPTM

CSP4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CSP4_ARATH
UniProt AC	Q38896
Protein Name	Cold shock domain-containing protein 4
Gene Name	CSP4
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	201
Subcellular Localization	Cytoplasm . Nucleus, nucleolus. Nucleus .
Protein Description	Chaperone that binds to and unwinds RNA and both single-stranded DNA and double-stranded DNA (ssDNA and dsDNA DNA) (By similarity). Regulates the flowering transition and flower and seed development, particularly at late stages of embryo development, through regulation of gene expression (including MEA, FIS2, AP1, CAL, AG and SHP2)..
Protein Sequence	MSGGGDVNMSGGDRRKGTVKWFDTQKGFGFITPSDGGDDLFVHQSSIRSEGFRSLAAEESVEFDVEVDNSGRPKAIEVSGPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGGLSCYSCGESGHFARDCTSGGAR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGGGDVNM ------CCCCCCCCC	46.26	22223895
2	Phosphorylation	------MSGGGDVNM ------CCCCCCCCC	46.26	27288362
10	Phosphorylation	GGGDVNMSGGDRRKG CCCCCCCCCCCCCCC	34.13	25561503
45	Phosphorylation	DDLFVHQSSIRSEGF CCEEEEHHHHCCCCH	16.92	23111157
46	Phosphorylation	DLFVHQSSIRSEGFR CEEEEHHHHCCCCHH	18.56	23572148
152	Phosphorylation	GHMARECSQGGGGYS CHHCEECCCCCCCCC	27.40	27531888
167	Phosphorylation	GGGGGGRYGSGGGGG CCCCCCCCCCCCCCC	20.93	27531888
169	Phosphorylation	GGGGRYGSGGGGGGG CCCCCCCCCCCCCCC	25.90	27531888
188	Phosphorylation	SCYSCGESGHFARDC CCCCCCCCCCCCCCC	23.89	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CSP4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CSP4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CSP4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CSP4_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CSP4_ARATH

Related Literatures of Post-Translational Modification