CSP2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSP2_ARATH
• UniProt AC: Q41188
• Protein Name: Cold shock protein 2
• Gene Name: CSP2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 203
• Subcellular Localization: Cytoplasm . Nucleus, nucleolus .
• Protein Description: Chaperone that binds to RNA, single- (ssDNA) and double-stranded (dsDNA) DNA, and unwinds nucleic acid duplex. Accelerates seed germination and seedling growth under cold stress, and contributes to enhancement of cold and freezing tolerance. Regulates flowering transition, and flower and seed development. Promotes seed germination under salt stress. May regulate respiratory oxygen uptake..
• Protein Sequence: MSGDNGGGERRKGSVKWFDTQKGFGFITPDDGGDDLFVHQSSIRSEGFRSLAAEEAVEFEVEIDNNNRPKAIDVSGPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESGHFARDCTSGGR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGDNGGGE ------CCCCCCCCC	55.65	-
41	Phosphorylation	DDLFVHQSSIRSEGF CCEEEEHHHHCCCCH	16.92	23111157
42	Phosphorylation	DLFVHQSSIRSEGFR CEEEEHHHHCCCCHH	18.56	30589143
86	Phosphorylation	GAPVQGNSGGGSSGG CCCCCCCCCCCCCCC	45.71	30407730
90	Phosphorylation	QGNSGGGSSGGRGGF CCCCCCCCCCCCCCC	29.14	30407730
91	Phosphorylation	GNSGGGSSGGRGGFG CCCCCCCCCCCCCCC	48.84	30589143
191	Phosphorylation	SCYSCGESGHFARDC CCCCCCCCCCCCCCC	23.89	24243849

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSP2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSP2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSP2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CSP2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.