dbPTM

CSN6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CSN6_CAEEL
UniProt AC	Q95PZ0
Protein Name	COP9 signalosome complex subunit 6
Gene Name	csn-6
Organism	Caenorhabditis elegans.
Sequence Length	426
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in embryogenesis and oogenesis and is required to regulate microtubule stability in the early embryo. Mediates mei-3/katanin targeting for degradation at the meiosis to mitosis transition via deneddylation of cul-3..
Protein Sequence	MALNAPSGSCSSKVLLHPLVIMQMSEHYSRTKVQQGPTVKKVFGAILGRQNGRQVEAINSFVLKMETEEMAEPVTFSTEHLLQRADQYLEVFPELQVIGLYCAGEDDNLTPEEKPLLSKLTNAVRNSEKAGQIDATLFLKLNSITAGTTRKLPLFAFEADVTDQEKHKPIEWILVSEESERVGVNHIAKLSTKHGKDGKSVGKKHAEAQDAAMSMLQNRVDLIVAYLEKVQDGTLQPNFEILKEANLLAQKLKTIDRYAAEFTDSFEKEEKTMTVFSLMPRLTTLLGNMQNVWNKLSAQRADLLADDGFHGKSTSRWAHPVRFKSQHLGRPQQADDDDYFDDEDLENDMSGPRRKIHAADSPAGSRRRRVPPRAMNFLGRNSGMQAATDEMELSGQEENMGSNYIPDVPRPSATAHNESDESSQAS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
361	Phosphorylation	RKIHAADSPAGSRRR CCEEECCCCCCCCCC	16.36	28854356
365	Phosphorylation	AADSPAGSRRRRVPP ECCCCCCCCCCCCCH	25.39	19060867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CSN6_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CSN6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CSN6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CSN4_CAEEL	csn-4	physical	18692475

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CSN6_CAEEL

Related Literatures of Post-Translational Modification