CSN2_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSN2_RAT
• UniProt AC: P61203
• Protein Name: COP9 signalosome complex subunit 2
• Gene Name: Cops2
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 443
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1..
• Protein Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
167	Acetylation	LEREEYGKLQKILRQ HCHHHHHHHHHHHHH	47.01	22902405
192	Phosphorylation	EDDLKKGTQLLEIYA CCHHHHHHHHHHHHH	25.56	25575281
198	Phosphorylation	GTQLLEIYALEIQMY HHHHHHHHHHHHHHH	8.85	25575281
205	Phosphorylation	YALEIQMYTAQKNNK HHHHHHHHHHHHCCH	5.20	25575281
206	Phosphorylation	ALEIQMYTAQKNNKK HHHHHHHHHHHCCHH	19.78	25575281
270	Phosphorylation	KNYDESGSPRRTTCL HCCCCCCCCCHHHHH	25.22	25403869
415	Acetylation	LLELDHQKRGGARYT HHHHHHHHCCCHHHH	49.98	22902405
415	Ubiquitination	LLELDHQKRGGARYT HHHHHHHHCCCHHHH	49.98	-
426	Acetylation	ARYTALDKWTNQLNS HHHHHHHHHHHHHHH	57.69	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSN2_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSN2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSN2_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of CSN2_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.