dbPTM

CSK2A_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CSK2A_CAEEL
UniProt AC	P18334
Protein Name	Casein kinase II subunit alpha
Gene Name	kin-3
Organism	Caenorhabditis elegans.
Sequence Length	360
Subcellular Localization	Cell projection, axon . Cell projection, cilium . Cell projection, dendrite . Perikaryon . Enriched in cilia in male sensory neurons.
Protein Description	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha chain contains the catalytic site. May participate in Wnt signaling. Modulates two aspects of male mating behavior; response to hermaphrodite contact and vulval location, acting in the same pathway as lov-1 and pkd-2..
Protein Sequence	MPPIPSRARVYAEVNPSRPREYWDYEAHMIEWGQIDDYQLVRKLGRGKYSEVFEGFKMSTDEKVVVKILKPVKKKKIKREIKILENLRGGTNIITLLDVVKDPISRTPALIFEHVNNSDFKQLYQTLSDYDIRYYLYELLKALDFCHSQGIMHRDVKPHNVMIDAEKRELRLIDWGLAEFYHPRQDYNVRVASRYFKGPELLVDYQCYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTDELYEYIARYHIDLDPRFNDILGRHSRKRWERFIHAENQHLVTPEALDFLDKLLRYDHAERLTAQEAMGHEYFRPVVEAHARANGTEQADGQGASNSASSQSSDAKIDGA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CSK2A_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CSK2A_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CSK2A_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CSK2A_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CSK2A_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CSK2A_CAEEL

Related Literatures of Post-Translational Modification