UniProt ID | CSDC2_MOUSE | |
---|---|---|
UniProt AC | Q91YQ3 | |
Protein Name | Cold shock domain-containing protein C2 | |
Gene Name | Csdc2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 154 | |
Subcellular Localization | Nucleus. Cytoplasm. PIPPin-RNA complexes are located to the nucleus.. | |
Protein Description | RNA-binding factor which binds specifically to the very 3'-UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).. | |
Protein Sequence | MTSESTLPPVVPPLHSPKSPVWPTFPFHREGSRIWERGGGIAPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKICPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | PVVPPLHSPKSPVWP CCCCCCCCCCCCCCC | 41.53 | 26643407 | |
19 | Phosphorylation | PPLHSPKSPVWPTFP CCCCCCCCCCCCCCC | 28.24 | 27180971 | |
32 | Phosphorylation | FPFHREGSRIWERGG CCCCCCCCCHHHCCC | 18.81 | - | |
37 | Methylation | EGSRIWERGGGIAPR CCCCHHHCCCCCCCC | 33.78 | - | |
48 | Phosphorylation | IAPRDLPSPLPTKRT CCCCCCCCCCCCCCC | 46.49 | 25521595 | |
52 | Phosphorylation | DLPSPLPTKRTRTYS CCCCCCCCCCCEEEE | 40.62 | 28066266 | |
59 | Phosphorylation | TKRTRTYSATARASA CCCCEEEEEECHHHC | 20.66 | 23737553 | |
65 | Phosphorylation | YSATARASAGPVFKG EEEECHHHCCHHHHH | 28.36 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSDC2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSDC2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSDC2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CSDC2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...