| UniProt ID | CRYAB_MOUSE | |
|---|---|---|
| UniProt AC | P23927 | |
| Protein Name | Alpha-crystallin B chain | |
| Gene Name | Cryab | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 175 | |
| Subcellular Localization | Cytoplasm . Nucleus . Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles. Localizes at the Z-bands and the intercalated disk in cardiomyocytes. | |
| Protein Description | May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.. | |
| Protein Sequence | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDIAIHHP -------CCCEECCC | 8.31 | - | |
| 19 | Phosphorylation | RPFFPFHSPSRLFDQ CCCCCCCCHHHHHHH | 25.58 | 9774459 | |
| 21 | Phosphorylation | FFPFHSPSRLFDQFF CCCCCCHHHHHHHHH | 44.63 | 23737553 | |
| 22 | Methylation | FPFHSPSRLFDQFFG CCCCCHHHHHHHHHH | 42.64 | - | |
| 45 | Phosphorylation | FSTATSLSPFYLRPP CCCCCCCCCCCCCCH | 16.84 | 9774459 | |
| 50 | Methylation | SLSPFYLRPPSFLRA CCCCCCCCCHHHHCC | 29.69 | - | |
| 59 | Phosphorylation | PSFLRAPSWIDTGLS HHHHCCCHHHHCCHH | 35.36 | 25521595 | |
| 63 | Phosphorylation | RAPSWIDTGLSEMRL CCCHHHHCCHHHHCC | 30.78 | 27742792 | |
| 66 | Phosphorylation | SWIDTGLSEMRLEKD HHHHCCHHHHCCCCC | 30.59 | 21082442 | |
| 72 | Ubiquitination | LSEMRLEKDRFSVNL HHHHCCCCCCEEEEE | 59.81 | 22790023 | |
| 76 | Phosphorylation | RLEKDRFSVNLDVKH CCCCCCEEEEEECCC | 15.81 | 26824392 | |
| 82 | Ubiquitination | FSVNLDVKHFSPEEL EEEEEECCCCCHHHH | 38.30 | 22790023 | |
| 85 | Phosphorylation | NLDVKHFSPEELKVK EEECCCCCHHHHEEE | 30.99 | 27742792 | |
| 90 | Ubiquitination | HFSPEELKVKVLGDV CCCHHHHEEEEEEEE | 43.20 | 22790023 | |
| 92 | Ubiquitination | SPEELKVKVLGDVIE CHHHHEEEEEEEEEE | 30.10 | 22790023 | |
| 92 | Acetylation | SPEELKVKVLGDVIE CHHHHEEEEEEEEEE | 30.10 | - | |
| 103 | Ubiquitination | DVIEVHGKHEERQDE EEEEECCCCCHHCCC | 32.72 | 22790023 | |
| 150 | Ubiquitination | LTVNGPRKQVSGPER EEECCCCCCCCCCCC | 59.18 | 22790023 | |
| 158 | Phosphorylation | QVSGPERTIPITREE CCCCCCCEECCCCCC | 29.46 | - | |
| 162 | O-linked_Glycosylation | PERTIPITREEKPAV CCCEECCCCCCCCCC | 27.03 | 30016717 | |
| 166 | Acetylation | IPITREEKPAVAAAP ECCCCCCCCCCEECC | 33.26 | - | |
| 166 | Ubiquitination | IPITREEKPAVAAAP ECCCCCCCCCCEECC | 33.26 | 22790023 | |
| 174 | Ubiquitination | PAVAAAPKK------ CCCEECCCC------ | 67.40 | - | |
| 175 | Ubiquitination | AVAAAPKK------- CCEECCCC------- | 65.59 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 45 | S | Phosphorylation | Kinase | ERK1 | P27361 | PSP |
| 45 | S | Phosphorylation | Kinase | PKN1 | P70268 | PSP |
| 59 | S | Phosphorylation | Kinase | P38A | Q16539 | PSP |
| 59 | S | Phosphorylation | Kinase | MAPK14 | P47811 | GPS |
| 59 | S | Phosphorylation | Kinase | PKN1 | P70268 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRYAB_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRYAB_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CRYAB_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...