UniProt ID | CRIPT_RAT | |
---|---|---|
UniProt AC | Q792Q4 | |
Protein Name | Cysteine-rich PDZ-binding protein | |
Gene Name | Cript | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 101 | |
Subcellular Localization | Cytoplasm . Cell junction, synapse . Cell projection, dendritic spine . Colocalizes with DLG4 in asymmetric synapses. | |
Protein Description | Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.. | |
Protein Sequence | MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Acetylation | ARFDPYGKNKFSTCR CCCCCCCCCCCCCCC | 51.63 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRIPT_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRIPT_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRIPT_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CRIPT_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...