dbPTM

CRI3_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CRI3_CAEEL
UniProt AC	Q21018
Protein Name	Conserved regulator of innate immunity protein 3
Gene Name	cri-3
Organism	Caenorhabditis elegans.
Sequence Length	236
Subcellular Localization	Mitochondrion matrix .
Protein Description
Protein Sequence	MNTASLVRSLSRVALRSSQVVRMAAPRHFSQSAKVLSVTPELQQALNREIEAEQQLSSDNLQGAVAPTFAGFQVTNKDAEVRLTKKNGSEDILVVFNVNHSVDMDEGFDDEPSQAVAPVPVAMPPFTVEITKGDQRLCFHLELVPVDDQPDEYDFRVEEFYVAPSAKNGNEDVPSEVYASSGKYIDPDLHDLLFVRYLEERGLDARFCKTLVAYATHYEHSQYVGLLDKIKKFISK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
39	Phosphorylation	SAKVLSVTPELQQAL CCEEEECCHHHHHHH	13.99	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CRI3_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CRI3_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CRI3_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RS8_CAEEL	rps-8	physical	14704431

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CRI3_CAEEL

Related Literatures of Post-Translational Modification