UniProt ID | CRBS_HUMAN | |
---|---|---|
UniProt AC | P22914 | |
Protein Name | Beta-crystallin S | |
Gene Name | CRYGS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | ||
Protein Description | Crystallins are the dominant structural components of the vertebrate eye lens.. | |
Protein Sequence | MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Glutathionylation | FQGRRYDCDCDCADF CCCCEEECCCCHHHH | 4.09 | 22833525 | |
25 | Glutathionylation | GRRYDCDCDCADFHT CCEEECCCCHHHHHH | 6.10 | 22833525 | |
27 | Glutathionylation | RYDCDCDCADFHTYL EEECCCCHHHHHHHH | 5.00 | 22833525 | |
83 | Glutathionylation | LNDRLSSCRAVHLPS CCHHHHCCEEEECCC | 2.66 | 22833525 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRBS_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRBS_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRBS_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CRBS_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
116100 | Cataract 20, multiple types (CTRCT20) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Methylation | |
Reference | PubMed |
"Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: METHYLATION [LARGE SCALE ANALYSIS] AT LYS-7, SUSCEPTIBILITY TOOXIDATION, AND MASS SPECTROMETRY. |