UniProt ID | CRBB1_HUMAN | |
---|---|---|
UniProt AC | P53674 | |
Protein Name | Beta-crystallin B1 | |
Gene Name | CRYBB1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 252 | |
Subcellular Localization | ||
Protein Description | Crystallins are the dominant structural components of the vertebrate eye lens.. | |
Protein Sequence | MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSQAAKASA ------CCHHHHHCC | 28.64 | 8626774 | |
6 | Acetylation | --MSQAAKASASATV --CCHHHHHCCCCEE | 45.98 | 12060738 | |
10 | Phosphorylation | QAAKASASATVAVNP HHHHHCCCCEEEECC | 23.21 | 22817900 | |
12 | Phosphorylation | AKASASATVAVNPGP HHHCCCCEEEECCCC | 13.40 | 22817900 | |
107 | Phosphorylation | PWVAFEQSNFRGEMF CEEEEECCCCCCEEE | 30.64 | 24719451 | |
130 | Phosphorylation | RWNTWSSSYRSDRLM CCCCCCCCCCCCCEE | 21.03 | 22964224 | |
131 | Phosphorylation | WNTWSSSYRSDRLMS CCCCCCCCCCCCEEE | 18.98 | 22964224 | |
138 | Phosphorylation | YRSDRLMSFRPIKMD CCCCCEEEECEECCC | 23.77 | 24719451 | |
160 | Acetylation | LFEGANFKGNTIEIQ EEECCCCCCCEEEEE | 51.57 | 12060738 | |
163 | Phosphorylation | GANFKGNTIEIQGDD CCCCCCCEEEEECCC | 28.76 | - | |
230 | Methylation | QPQMQSLRRLRDKQW HHHHHHHHHHHHCCC | 40.61 | - | |
231 | Methylation | PQMQSLRRLRDKQWH HHHHHHHHHHHCCCC | 39.09 | - | |
235 | Methylation | SLRRLRDKQWHLEGS HHHHHHHCCCCCCCC | 49.18 | 12060738 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRBB1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRBB1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRBB1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CRBB1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
611544 | Cataract 17, multiple types (CTRCT17) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10 AND THR-12,ACETYLATION AT LYS-6 AND LYS-160, METHYLATION AT ARG-230; ARG-231 ANDLYS-235, SUSCEPTIBILITY TO OXIDATION, AND MASS SPECTROMETRY. | |
Methylation | |
Reference | PubMed |
"Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10 AND THR-12,ACETYLATION AT LYS-6 AND LYS-160, METHYLATION AT ARG-230; ARG-231 ANDLYS-235, SUSCEPTIBILITY TO OXIDATION, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10 AND THR-12,ACETYLATION AT LYS-6 AND LYS-160, METHYLATION AT ARG-230; ARG-231 ANDLYS-235, SUSCEPTIBILITY TO OXIDATION, AND MASS SPECTROMETRY. |