CRBA2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRBA2_HUMAN
• UniProt AC: P53672
• Protein Name: Beta-crystallin A2
• Gene Name: CRYBA2
• Organism: Homo sapiens (Human).
• Sequence Length: 197
• Protein Description: Crystallins are the dominant structural components of the vertebrate eye lens..
• Protein Sequence: MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	GRRCRLLSDCANVCE CCCEEHHHHHHHHHH	34.92	12907171
94	Phosphorylation	HNSNQLLSFRPVLCA CCCCCEEEEEEEEEE	28.00	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CRBA2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRBA2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRBA2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CACO1_HUMAN	CALCOCO1	physical	16189514
PCH2_HUMAN	TRIP13	physical	19060904

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 115900: Cataract 42 (CTRCT42)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.