| UniProt ID | CR032_HUMAN | |
|---|---|---|
| UniProt AC | Q8TCD1 | |
| Protein Name | UPF0729 protein C18orf32 | |
| Gene Name | C18orf32 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 76 | |
| Subcellular Localization | ||
| Protein Description | May activate the NF-kappa-B signaling pathway.. | |
| Protein Sequence | MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | YKKFLEPYIYPLVSP HHHHHHHHHHHHHHH | 12.05 | - | |
| 25 | Phosphorylation | KFLEPYIYPLVSPFV HHHHHHHHHHHHHHH | 5.67 | - | |
| 38 | Ubiquitination | FVSRIWPKKAIQESN HHHHHCCHHHHHCCC | 39.58 | 23000965 | |
| 39 | Ubiquitination | VSRIWPKKAIQESND HHHHCCHHHHHCCCC | 46.79 | 23000965 | |
| 49 | Ubiquitination | QESNDTNKGKVNFKG HCCCCCCCCEECCCC | 63.30 | 33845483 | |
| 51 | Ubiquitination | SNDTNKGKVNFKGAD CCCCCCCEECCCCCC | 35.30 | 27667366 | |
| 55 | Ubiquitination | NKGKVNFKGADMNGL CCCEECCCCCCCCCC | 48.24 | 33845483 | |
| 64 | O-linked_Glycosylation | ADMNGLPTKGPTEIC CCCCCCCCCCCCCCC | 54.39 | OGP | |
| 65 | Ubiquitination | DMNGLPTKGPTEICD CCCCCCCCCCCCCCC | 62.04 | 32142685 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CR032_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CR032_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CR032_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CR032_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...