UniProt ID | CPSF4_MOUSE | |
---|---|---|
UniProt AC | Q8BQZ5 | |
Protein Name | Cleavage and polyadenylation specificity factor subunit 4 | |
Gene Name | Cpsf4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 211 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U) (By similarity).. | |
Protein Sequence | MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPTKRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Phosphorylation | MCPFRHISGEKTVVC CCCCEECCCCCEEEE | 34.47 | 23737553 | |
169 | Phosphorylation | QVIGVMQSQNSSAGN CEEEEEECCCCCCCC | 17.15 | - | |
172 | Phosphorylation | GVMQSQNSSAGNRGP EEEECCCCCCCCCCC | 17.58 | - | |
173 | Phosphorylation | VMQSQNSSAGNRGPR EEECCCCCCCCCCCC | 47.98 | - | |
209 | Phosphorylation | KGHLAFLSGQ----- CCCHHHHCCC----- | 28.79 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPSF4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPSF4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPSF4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CPSF4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...