| UniProt ID | CPNS1_MOUSE | |
|---|---|---|
| UniProt AC | O88456 | |
| Protein Name | Calpain small subunit 1 | |
| Gene Name | Capns1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 269 | |
| Subcellular Localization | Cytoplasm. Cell membrane. Translocates to the plasma membrane upon calcium binding.. | |
| Protein Description | Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.. | |
| Protein Sequence | MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAAGGGGGGGGGGMGLGGGGGGGGTAMRILGGVISAISEAAAQYNPEPPPPRSHYSNIEANESEEVRQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKRFDTDRSGTIGSHELPGAFEAAGFHLNEHLYSMIIRRYADESGNMDFDNFISCLVRLDAMFRAFKSLDKNGTGQIQVNIQEWLQLTMYS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MFLVNSFL -------CCCCCCCC | 5.45 | - | |
| 6 | Phosphorylation | --MFLVNSFLKGGGG --CCCCCCCCCCCCC | 25.20 | 29514104 | |
| 33 | Phosphorylation | NVLGGLISGAAGGGG HHHHHHHHCCCCCCC | 27.67 | 25777480 | |
| 58 | Phosphorylation | GGGGGGGTAMRILGG CCCCCHHHHHHHHHH | 22.13 | 25777480 | |
| 67 | Phosphorylation | MRILGGVISAISEAA HHHHHHHHHHHHHHH | 2.32 | 24719451 | |
| 68 | Phosphorylation | RILGGVISAISEAAA HHHHHHHHHHHHHHH | 19.69 | - | |
| 88 | Phosphorylation | PPPPRSHYSNIEANE CCCCCHHCCCCCCCC | 12.50 | 29514104 | |
| 117 | Phosphorylation | AGDDMEVSATELMNI HCCCCCCCHHHHHHH | 19.03 | 28609623 | |
| 119 | Phosphorylation | DDMEVSATELMNILN CCCCCCHHHHHHHHH | 23.34 | 28609623 | |
| 130 | Phosphorylation | NILNKVVTRHPDLKT HHHHHHHHHCCCCCC | 26.67 | 28609623 | |
| 166 | Ubiquitination | KLGFEEFKYLWNNIK CCCHHHHHHHHHHHH | 42.59 | - | |
| 173 | Acetylation | KYLWNNIKKWQAIYK HHHHHHHHHHHHHHH | 50.51 | 23236377 | |
| 180 | Acetylation | KKWQAIYKRFDTDRS HHHHHHHHHHCCCCC | 40.24 | 88583 | |
| 180 | Malonylation | KKWQAIYKRFDTDRS HHHHHHHHHHCCCCC | 40.24 | 26320211 | |
| 233 | Glutathionylation | DFDNFISCLVRLDAM CHHHHHHHHHHHHHH | 3.30 | 24333276 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPNS1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPNS1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPNS1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CPNS1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
