dbPTM

CPG3_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CPG3_CAEEL
UniProt AC	Q21771
Protein Name	Chondroitin proteoglycan 3
Gene Name	cpg-3 {ECO:0000312\|EMBL:CAA95840.1, ECO:0000312\|WormBase:R06C7.4}
Organism	Caenorhabditis elegans.
Sequence Length	292
Subcellular Localization
Protein Description
Protein Sequence	MRFVFIIALLLIGASLAHPADPIRAKRDVSASEDEFSGDSSGEISGESSGEASGEASGEASGEASGEASGESSGETSGESSGDEETSGEGSGEEGSGDTSPVVPVDELTLQQLETLNTYAQQVQAESQKLIHQANFVITEMTALSANAQNLGILSNIVLANSQMVLDSARLSLNETETETGTSAPATCVSSAVCYGDSGCGSGKCIGALAGTCNCNSCVFGWPCQEDSACGGFNGACNSITATCDCFAAYTKNNLTLAEALTSFCNVETCNGAEDNVEKCHGLPCNYGFCVC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
174	N-linked_Glycosylation	DSARLSLNETETETG HCCEECCCCCCCCCC	51.25	17761667
254	N-linked_Glycosylation	FAAYTKNNLTLAEAL EEHHCCCCCCHHHHH	35.64	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CPG3_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CPG3_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CPG3_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CPG3_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CPG3_CAEEL

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Proteomics reveals N-linked glycoprotein diversity in Caenorhabditiselegans and suggests an atypical translocation mechanism for integralmembrane proteins."; Kaji H., Kamiie J., Kawakami H., Kido K., Yamauchi Y., Shinkawa T.,Taoka M., Takahashi N., Isobe T.; Mol. Cell. Proteomics 6:2100-2109(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-174, AND MASSSPECTROMETRY.	17761667 [Abstract]