UniProt ID | CP41A_ARATH | |
---|---|---|
UniProt AC | Q9LYA9 | |
Protein Name | Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic | |
Gene Name | CSP41A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 406 | |
Subcellular Localization | Plastid, chloroplast, plastoglobule . Present in stromules.. | |
Protein Description | Binds and cleaves RNA, particularly in stem-loops. Associates with pre-ribosomal particles in chloroplasts, and participates in chloroplast ribosomal RNA metabolism, probably during the final steps of 23S rRNA maturation. May enhance transcription by the plastid-encoded polymerase and translation in plastid via the stabilization of ribosome assembly intermediates. Required for chloroplast integrity. Involved in the regulation of the circadian system.. | |
Protein Sequence | MAALSSSSLFFSSKTTSPISNLLIPPSLHRFSLPSSSSSFSSLSSSSSSSSSLLTFSLRTSRRLSPQKFTVKASSVGEKKNVLIVNTNSGGHAVIGFYFAKELLSAGHAVTILTVGDESSEKMKKPPFNRFSEIVSGGGKTVWGNPANVANVVGGETFDVVLDNNGKDLDTVRPVVDWAKSSGVKQFLFISSAGIYKSTEQPPHVEGDAVKADAGHVVVEKYLAETFGNWASFRPQYMIGSGNNKDCEEWFFDRIVRDRAVPIPGSGLQLTNISHVRDLSSMLTSAVANPEAASGNIFNCVSDRAVTLDGMAKLCAAAAGKTVEIVHYDPKAIGVDAKKAFLFRNMHFYAEPRAAKDLLGWESKTNLPEDLKERFEEYVKIGRDKKEIKFELDDKILEALKTPVAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | SSSSLFFSSKTTSPI CCCCCCCCCCCCCCC | 24.48 | 19880383 | |
132 | Phosphorylation | KPPFNRFSEIVSGGG CCCCCCCHHHHCCCC | 24.15 | 25561503 | |
136 | Phosphorylation | NRFSEIVSGGGKTVW CCCHHHHCCCCCEEC | 37.06 | 28295753 | |
198 | Phosphorylation | SSAGIYKSTEQPPHV ECCCEECCCCCCCCC | 21.87 | 23111157 | |
199 | Phosphorylation | SAGIYKSTEQPPHVE CCCEECCCCCCCCCC | 34.19 | 19376835 | |
266 | Phosphorylation | RAVPIPGSGLQLTNI CCCCCCCCCCEEECC | 30.86 | 22092075 | |
271 | Phosphorylation | PGSGLQLTNISHVRD CCCCCEEECCHHHHH | 19.97 | 19880383 | |
274 | Phosphorylation | GLQLTNISHVRDLSS CCEEECCHHHHHHHH | 20.28 | 19880383 | |
338 | Acetylation | KAIGVDAKKAFLFRN HHHCCCHHHHHHHCC | 39.92 | 21311031 | |
365 | Phosphorylation | LLGWESKTNLPEDLK HHCCCCCCCCCHHHH | 51.79 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP41A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP41A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP41A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CP41B_ARATH | CRB | physical | 19067181 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...