CP41A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CP41A_ARATH
• UniProt AC: Q9LYA9
• Protein Name: Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic
• Gene Name: CSP41A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 406
• Subcellular Localization: Plastid, chloroplast, plastoglobule . Present in stromules..
• Protein Description: Binds and cleaves RNA, particularly in stem-loops. Associates with pre-ribosomal particles in chloroplasts, and participates in chloroplast ribosomal RNA metabolism, probably during the final steps of 23S rRNA maturation. May enhance transcription by the plastid-encoded polymerase and translation in plastid via the stabilization of ribosome assembly intermediates. Required for chloroplast integrity. Involved in the regulation of the circadian system..
• Protein Sequence: MAALSSSSLFFSSKTTSPISNLLIPPSLHRFSLPSSSSSFSSLSSSSSSSSSLLTFSLRTSRRLSPQKFTVKASSVGEKKNVLIVNTNSGGHAVIGFYFAKELLSAGHAVTILTVGDESSEKMKKPPFNRFSEIVSGGGKTVWGNPANVANVVGGETFDVVLDNNGKDLDTVRPVVDWAKSSGVKQFLFISSAGIYKSTEQPPHVEGDAVKADAGHVVVEKYLAETFGNWASFRPQYMIGSGNNKDCEEWFFDRIVRDRAVPIPGSGLQLTNISHVRDLSSMLTSAVANPEAASGNIFNCVSDRAVTLDGMAKLCAAAAGKTVEIVHYDPKAIGVDAKKAFLFRNMHFYAEPRAAKDLLGWESKTNLPEDLKERFEEYVKIGRDKKEIKFELDDKILEALKTPVAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	SSSSLFFSSKTTSPI CCCCCCCCCCCCCCC	24.48	19880383
132	Phosphorylation	KPPFNRFSEIVSGGG CCCCCCCHHHHCCCC	24.15	25561503
136	Phosphorylation	NRFSEIVSGGGKTVW CCCHHHHCCCCCEEC	37.06	28295753
198	Phosphorylation	SSAGIYKSTEQPPHV ECCCEECCCCCCCCC	21.87	23111157
199	Phosphorylation	SAGIYKSTEQPPHVE CCCEECCCCCCCCCC	34.19	19376835
266	Phosphorylation	RAVPIPGSGLQLTNI CCCCCCCCCCEEECC	30.86	22092075
271	Phosphorylation	PGSGLQLTNISHVRD CCCCCEEECCHHHHH	19.97	19880383
274	Phosphorylation	GLQLTNISHVRDLSS CCEEECCHHHHHHHH	20.28	19880383
338	Acetylation	KAIGVDAKKAFLFRN HHHCCCHHHHHHHCC	39.92	21311031
365	Phosphorylation	LLGWESKTNLPEDLK HHCCCCCCCCCHHHH	51.79	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CP41A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CP41A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CP41A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CP41B_ARATH	CRB	physical	19067181

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.