UniProt ID | CP31A_ARATH | |
---|---|---|
UniProt AC | Q04836 | |
Protein Name | 31 kDa ribonucleoprotein, chloroplastic | |
Gene Name | CP31A {ECO:0000303|PubMed:19297624} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 329 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | Required for specific RNA editing events in chloroplasts and stabilizes specific chloroplast mRNAs. Associates with the 3'-terminus ndhF mRNAs and protects them against 3'-exonucleolytic degradation. [PubMed: 19297624] | |
Protein Sequence | MASSIVTSSLKPLAMADSSSSTIFSHPSISSTISSSRIRSSSVSLLTGRINLPLSFSRVSLSLKTKTHLKKSPFVSFVAQTSDWAEEGGEGSVAVEETENSLESQDVSEGDESEGDASEGDVSEGDESEGDVSEGAVSERAEFPEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAEERPPRRGY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Phosphorylation | SSRIRSSSVSLLTGR CHHHHHCCEEEEECC | 19880383 | ||
47 | Phosphorylation | SSSVSLLTGRINLPL HCCEEEEECCEECCC | 23820729 | ||
62 | Phosphorylation | SFSRVSLSLKTKTHL CEEEEEEECCCCCCC | 28011693 | ||
123 | Phosphorylation | DASEGDVSEGDESEG CCCCCCCCCCCCCCC | 19376835 | ||
128 | Phosphorylation | DVSEGDESEGDVSEG CCCCCCCCCCCCCCC | 19376835 | ||
133 | Phosphorylation | DESEGDVSEGAVSER CCCCCCCCCCCCCCC | 29654922 | ||
206 | Phosphorylation | SSVDEAETAVEKFNR CCHHHHHHHHHHHHH | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP31A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP31A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP31A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CP31A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...