dbPTM

CP2E1_RABIT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CP2E1_RABIT
UniProt AC	P08682
Protein Name	Cytochrome P450 2E1
Gene Name	CYP2E1
Organism	Oryctolagus cuniculus (Rabbit).
Sequence Length	493
Subcellular Localization	Endoplasmic reticulum membrane Peripheral membrane protein. Microsome membrane Peripheral membrane protein.
Protein Description	Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites..
Protein Sequence	MAVLGITVALLGWMVILLFISVWKQIHSSWNLPPGPFPLPIIGNLLQLDLKDIPKSFGRLAERFGPVFTVYLGSRRVVVLHGYKAVREMLLNHKNEFSGRGEIPAFREFKDKGIIFNNGPTWKDTRRFSLTTLRDYGMGKQGNEDRIQKEAHFLLEELRKTQGQPFDPTFVIGCTPFNVIAKILFNDRFDYKDKQALRLMSLFNENFYLLSTPWLQVYNNFSNYLQYMPGSHRKVIKNVSEIKEYTLARVKEHHKSLDPSCPRDFIDSLLIEMEKDKHSTEPLYTLENIAVTVADMFFAGTETTSTTLRYGLLILLKHPEIEEKLHEEIDRVIGPSRMPSVRDRVQMPYMDAVVHEIQRFIDLVPSNLPHEATRDTTFQGYVIPKGTVVIPTLDSLLYDKQEFPDPEKFKPEHFLNEEGKFKYSDYFKPFSAGKRVCVGEGLARMELFLLLSAILQHFNLKPLVDPEDIDLRNITVGFGRVPPRYKLCVIPRS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CP2E1_RABIT !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CP2E1_RABIT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CP2E1_RABIT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CP2E1_RABIT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBC_HUMAN	UBC	physical	16331994

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CP2E1_RABIT

Related Literatures of Post-Translational Modification