UniProt ID | CP2E1_RABIT | |
---|---|---|
UniProt AC | P08682 | |
Protein Name | Cytochrome P450 2E1 | |
Gene Name | CYP2E1 | |
Organism | Oryctolagus cuniculus (Rabbit). | |
Sequence Length | 493 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein. Microsome membrane Peripheral membrane protein. |
|
Protein Description | Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites.. | |
Protein Sequence | MAVLGITVALLGWMVILLFISVWKQIHSSWNLPPGPFPLPIIGNLLQLDLKDIPKSFGRLAERFGPVFTVYLGSRRVVVLHGYKAVREMLLNHKNEFSGRGEIPAFREFKDKGIIFNNGPTWKDTRRFSLTTLRDYGMGKQGNEDRIQKEAHFLLEELRKTQGQPFDPTFVIGCTPFNVIAKILFNDRFDYKDKQALRLMSLFNENFYLLSTPWLQVYNNFSNYLQYMPGSHRKVIKNVSEIKEYTLARVKEHHKSLDPSCPRDFIDSLLIEMEKDKHSTEPLYTLENIAVTVADMFFAGTETTSTTLRYGLLILLKHPEIEEKLHEEIDRVIGPSRMPSVRDRVQMPYMDAVVHEIQRFIDLVPSNLPHEATRDTTFQGYVIPKGTVVIPTLDSLLYDKQEFPDPEKFKPEHFLNEEGKFKYSDYFKPFSAGKRVCVGEGLARMELFLLLSAILQHFNLKPLVDPEDIDLRNITVGFGRVPPRYKLCVIPRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CP2E1_RABIT !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP2E1_RABIT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP2E1_RABIT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP2E1_RABIT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...