dbPTM

CP20C_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CP20C_ARATH
UniProt AC	P34791
Protein Name	Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic
Gene Name	CYP20-3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	260
Subcellular Localization	Plastid, chloroplast stroma . Probably associated to membranes.
Protein Description	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Required for the light-induced increase of thiol accumulation. Assists the folding or assembly of SAT1 enzyme to form the cysteine synthase complex. Links light and redox signals to the regulation of cysteine biosynthesis in response to stress..
Protein Sequence	MASSSSMQMVHTSRSIAQIGFGVKSQLVSANRTTQSVCFGARSSGIALSSRLHYASPIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPLDA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
143	Phosphorylation	KYGYKGSSFHRIIKD CCCCCCCHHHHHHHH	33.47	27531888
227	Sulfoxidation	FGQVIEGMKLVRTLE EEEEEECCEEEEECC	1.65	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CP20C_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CP20C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CP20C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SAT1_ARATH	SERAT2;1	physical	23671085

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CP20C_ARATH

Related Literatures of Post-Translational Modification