UniProt ID | CP095_HUMAN | |
---|---|---|
UniProt AC | Q9H693 | |
Protein Name | Uncharacterized protein C16orf95 | |
Gene Name | C16orf95 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKKEVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MRASRSPPSPR ----CCCCCCCCCCC | 23.95 | - | |
6 | Phosphorylation | --MRASRSPPSPRRC --CCCCCCCCCCCCC | 38.37 | 15302935 | |
9 | Phosphorylation | RASRSPPSPRRCHHH CCCCCCCCCCCCCCC | 34.13 | 15302935 | |
53 | Phosphorylation | SAQDGRNSTFQTYKK CCCCCCCCCCHHCCC | 29.28 | 24719451 | |
54 | Phosphorylation | AQDGRNSTFQTYKKE CCCCCCCCCHHCCCE | 24.26 | 24719451 | |
120 | Phosphorylation | CWMHAAGTTAGGSAV CEEEECCCCCCCCHH | 14.56 | - | |
121 | Phosphorylation | WMHAAGTTAGGSAVM EEEECCCCCCCCHHH | 23.53 | - | |
125 | Phosphorylation | AGTTAGGSAVMSACC CCCCCCCCHHHHHCC | 19.44 | - | |
129 | Phosphorylation | AGGSAVMSACCPSSS CCCCHHHHHCCCCCC | 16.14 | - | |
144 | O-linked_Glycosylation | SSRPPTRTSYRLLQR CCCCCCHHHHHHHHH | 32.37 | 30620550 | |
144 | Phosphorylation | SSRPPTRTSYRLLQR CCCCCCHHHHHHHHH | 32.37 | 25690035 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP095_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP095_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP095_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CP095_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...