| UniProt ID | CP095_HUMAN | |
|---|---|---|
| UniProt AC | Q9H693 | |
| Protein Name | Uncharacterized protein C16orf95 | |
| Gene Name | C16orf95 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 158 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKKEVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MRASRSPPSPR ----CCCCCCCCCCC | 23.95 | - | |
| 6 | Phosphorylation | --MRASRSPPSPRRC --CCCCCCCCCCCCC | 38.37 | 15302935 | |
| 9 | Phosphorylation | RASRSPPSPRRCHHH CCCCCCCCCCCCCCC | 34.13 | 15302935 | |
| 53 | Phosphorylation | SAQDGRNSTFQTYKK CCCCCCCCCCHHCCC | 29.28 | 24719451 | |
| 54 | Phosphorylation | AQDGRNSTFQTYKKE CCCCCCCCCHHCCCE | 24.26 | 24719451 | |
| 120 | Phosphorylation | CWMHAAGTTAGGSAV CEEEECCCCCCCCHH | 14.56 | - | |
| 121 | Phosphorylation | WMHAAGTTAGGSAVM EEEECCCCCCCCHHH | 23.53 | - | |
| 125 | Phosphorylation | AGTTAGGSAVMSACC CCCCCCCCHHHHHCC | 19.44 | - | |
| 129 | Phosphorylation | AGGSAVMSACCPSSS CCCCHHHHHCCCCCC | 16.14 | - | |
| 144 | O-linked_Glycosylation | SSRPPTRTSYRLLQR CCCCCCHHHHHHHHH | 32.37 | 30620550 | |
| 144 | Phosphorylation | SSRPPTRTSYRLLQR CCCCCCHHHHHHHHH | 32.37 | 25690035 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP095_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP095_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP095_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CP095_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...