UniProt ID | CP078_HUMAN | |
---|---|---|
UniProt AC | Q8WTQ4 | |
Protein Name | Uncharacterized protein C16orf78 | |
Gene Name | C16orf78 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 265 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSEQQMDLKDLMPTKRKYMWKTAEDRRMSDLTCVLEWLERRQGKKKQAPEKQKPKVVTVLKRNKKKEEKKGKGLMTARGGNRRDTETSQQALGKRFRKDAASYRSLYGVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIVLDPMLQEGTFNSQRATFIRDWSNKMPDMAYERKLKSLMEKSTEPKMETMRMLKPEEVLSCRYLRLSKENIRTLLKLCKDAGMNVDIHPHMVEEDIDAKKVFTGIPSMAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSEQQMDLK ------CCHHHCCHH | 44.08 | 24043423 | |
18 | Phosphorylation | LMPTKRKYMWKTAED HCCCHHHHHHHHHHH | 16.55 | 26074081 | |
44 | Ubiquitination | WLERRQGKKKQAPEK HHHHHCCCCCCCCCH | 48.75 | 22817900 | |
45 | Ubiquitination | LERRQGKKKQAPEKQ HHHHCCCCCCCCCHH | 57.87 | 21890473 | |
46 | Ubiquitination | ERRQGKKKQAPEKQK HHHCCCCCCCCCHHC | 56.00 | 21890473 | |
51 | Ubiquitination | KKKQAPEKQKPKVVT CCCCCCCHHCCCEEE | 63.66 | 22817900 | |
66 | Ubiquitination | VLKRNKKKEEKKGKG EECCCCCHHHHCCCC | 73.11 | - | |
102 | Phosphorylation | RFRKDAASYRSLYGV HHHHHHHHHHHHHCH | 23.85 | 30622161 | |
105 | Phosphorylation | KDAASYRSLYGVEQK HHHHHHHHHHCHHHC | 20.08 | 30622161 | |
107 | Phosphorylation | AASYRSLYGVEQKGK HHHHHHHHCHHHCCC | 22.00 | 29496907 | |
123 | Phosphorylation | LSMVPGSYIKDGPKK EEECCCHHCCCCCCC | 20.22 | - | |
144 | Phosphorylation | DAVDPESTQRPNPFR HCCCHHHCCCCCCCC | 27.25 | - | |
154 | Phosphorylation | PNPFRRQSIVLDPML CCCCCCCEEEECHHH | 16.92 | 30622161 | |
172 | Phosphorylation | TFNSQRATFIRDWSN CCCCHHHHHHHHHHH | 23.06 | 23186163 | |
192 | Phosphorylation | AYERKLKSLMEKSTE HHHHHHHHHHHHCCC | 43.30 | 24043423 | |
197 | Phosphorylation | LKSLMEKSTEPKMET HHHHHHHCCCCCHHH | 25.38 | 24043423 | |
198 | Phosphorylation | KSLMEKSTEPKMETM HHHHHHCCCCCHHHH | 68.33 | 24043423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP078_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP078_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP078_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CP078_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...