UniProt ID | COXM1_HUMAN | |
---|---|---|
UniProt AC | Q7Z7K0 | |
Protein Name | COX assembly mitochondrial protein homolog | |
Gene Name | CMC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 106 | |
Subcellular Localization | Mitochondrion . Colocalizes with MT-CO1. | |
Protein Description | Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly.. | |
Protein Sequence | MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MALDPADQH ------CCCCHHHHH | 22.22 | 25944712 | |
15 | Ubiquitination | QHLRHVEKDVLIPKI HHHHHHHHHCHHHHH | 52.64 | - | |
15 | 2-Hydroxyisobutyrylation | QHLRHVEKDVLIPKI HHHHHHHHHCHHHHH | 52.64 | - | |
40 | Ubiquitination | EQVQDFTKCCKNSGV HHHHHHHHHHHCCCC | 37.31 | - | |
43 | Ubiquitination | QDFTKCCKNSGVLMV HHHHHHHHCCCCEEE | 64.71 | - | |
45 | Phosphorylation | FTKCCKNSGVLMVVK HHHHHHCCCCEEEEE | 18.77 | 20071362 | |
95 | Phosphorylation | FRKTGIPTKKRLQKL HHHHCCCCHHHHHCC | 47.48 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COXM1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COXM1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COXM1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COXM1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |