dbPTM

COX7B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COX7B_HUMAN
UniProt AC	P24311
Protein Name	Cytochrome c oxidase subunit 7B, mitochondrial
Gene Name	COX7B
Organism	Homo sapiens (Human).
Sequence Length	80
Subcellular Localization	Mitochondrion inner membrane.
Protein Description	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Plays a role in proper central nervous system (CNS) development in vertebrates..
Protein Sequence	MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
30	Phosphorylation	RQSHQKRTPDFHDKY HHHHHHCCCCHHHHH	33.96	26437602
75	Ubiquitination	PVGRVTPKEWRNQ-- CCCCCCCHHHHCC--	61.62	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COX7B_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COX7B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COX7B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COX7B_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
300887	Linear skin defects with multiple congenital anomalies 2 (LSDMCA2)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB02659	Cholic Acid

Regulatory Network of COX7B_HUMAN

Related Literatures of Post-Translational Modification