dbPTM

COX7A_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COX7A_DROME
UniProt AC	Q9VHS2
Protein Name	Cytochrome c oxidase subunit 7A, mitochondrial
Gene Name	COX7A {ECO:0000312\|FlyBase:FBgn0040529}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	89
Subcellular Localization	Mitochondrion inner membrane.
Protein Description	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport..
Protein Sequence	MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of COX7A_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COX7A_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COX7A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COX7A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COX7A_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COX7A_DROME

Related Literatures of Post-Translational Modification