| UniProt ID | COX5A_MOUSE | |
|---|---|---|
| UniProt AC | P12787 | |
| Protein Name | Cytochrome c oxidase subunit 5A, mitochondrial | |
| Gene Name | Cox5a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 146 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
| Protein Sequence | MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Phosphorylation | VCSIRCYSHGSHETD HHEEEEECCCCCCCC | 25.62 | 21082442 | |
| 41 | Phosphorylation | IRCYSHGSHETDEEF EEEECCCCCCCCHHC | 16.84 | 21082442 | |
| 44 | Phosphorylation | YSHGSHETDEEFDAR ECCCCCCCCHHCCHH | 43.20 | 23608596 | |
| 58 | Acetylation | RWVTYFNKPDIDAWE HHHHHCCCCCCCHHH | 33.88 | 23864654 | |
| 58 | Succinylation | RWVTYFNKPDIDAWE HHHHHCCCCCCCHHH | 33.88 | 26388266 | |
| 68 | Ubiquitination | IDAWELRKGMNTLVG CCHHHHHCCCCCCCC | 75.12 | 22790023 | |
| 68 | Acetylation | IDAWELRKGMNTLVG CCHHHHHCCCCCCCC | 75.12 | 24062335 | |
| 76 | Phosphorylation | GMNTLVGYDLVPEPK CCCCCCCCCCCCCHH | 9.91 | 25195567 | |
| 83 | Ubiquitination | YDLVPEPKIIDAALR CCCCCCHHHHHHHHH | 51.11 | - | |
| 83 | Acetylation | YDLVPEPKIIDAALR CCCCCCHHHHHHHHH | 51.11 | 23576753 | |
| 83 | Succinylation | YDLVPEPKIIDAALR CCCCCCHHHHHHHHH | 51.11 | 24315375 | |
| 100 | O-linked_Glycosylation | RRLNDFASAVRILEV HHHHHHHHHHHHHHH | 27.56 | 55411627 | |
| 109 | Acetylation | VRILEVVKDKAGPHK HHHHHHHHCCCCCCC | 59.70 | 23576753 | |
| 109 | Ubiquitination | VRILEVVKDKAGPHK HHHHHHHHCCCCCCC | 59.70 | 27667366 | |
| 109 | Succinylation | VRILEVVKDKAGPHK HHHHHHHHCCCCCCC | 59.70 | 26388266 | |
| 137 | Phosphorylation | LNELGISTPEELGLD HHHHCCCCHHHHCCC | 32.57 | - | |
| 145 | Acetylation | PEELGLDKV------ HHHHCCCCC------ | 55.69 | 23954790 | |
| 145 | Succinylation | PEELGLDKV------ HHHHCCCCC------ | 55.69 | 23806337 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX5A_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX5A_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX5A_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of COX5A_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...