| UniProt ID | COX41_RAT | |
|---|---|---|
| UniProt AC | P10888 | |
| Protein Name | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial | |
| Gene Name | Cox4i1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 169 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
| Protein Sequence | MLATRALSLIGKRAISTSVCLRAHGSVVKSEDYALPSYVDRRDYPLPDVAHVKLLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNKGTNEWKTVVGLAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKVNPIQGFSAKWDYNKNEWKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | VCLRAHGSVVKSEDY HHHHHCCCEECCCCC | 17.55 | 23984901 | |
| 29 | Succinylation | RAHGSVVKSEDYALP HHCCCEECCCCCCCC | 46.07 | - | |
| 29 | Acetylation | RAHGSVVKSEDYALP HHCCCEECCCCCCCC | 46.07 | 22902405 | |
| 29 | Succinylation | RAHGSVVKSEDYALP HHCCCEECCCCCCCC | 46.07 | - | |
| 30 | Phosphorylation | AHGSVVKSEDYALPS HCCCEECCCCCCCCC | 24.88 | 23991683 | |
| 33 | Phosphorylation | SVVKSEDYALPSYVD CEECCCCCCCCCCCC | 13.14 | 22673903 | |
| 37 | Phosphorylation | SEDYALPSYVDRRDY CCCCCCCCCCCCCCC | 38.34 | 22673903 | |
| 38 | Phosphorylation | EDYALPSYVDRRDYP CCCCCCCCCCCCCCC | 12.39 | 22673903 | |
| 44 | Phosphorylation | SYVDRRDYPLPDVAH CCCCCCCCCCCCHHH | 12.59 | 30181290 | |
| 53 | Acetylation | LPDVAHVKLLSASQK CCCHHHHHHHHHHHH | 33.57 | 22902405 | |
| 56 | Phosphorylation | VAHVKLLSASQKALK HHHHHHHHHHHHHHH | 35.99 | 23991683 | |
| 58 | Phosphorylation | HVKLLSASQKALKEK HHHHHHHHHHHHHHH | 28.92 | 22108457 | |
| 60 | Acetylation | KLLSASQKALKEKEK HHHHHHHHHHHHHHH | 53.87 | 22902405 | |
| 60 | Succinylation | KLLSASQKALKEKEK HHHHHHHHHHHHHHH | 53.87 | - | |
| 60 | Succinylation | KLLSASQKALKEKEK HHHHHHHHHHHHHHH | 53.87 | 26843850 | |
| 63 | Acetylation | SASQKALKEKEKADW HHHHHHHHHHHHCCH | 72.15 | 26302492 | |
| 65 | Acetylation | SQKALKEKEKADWSS HHHHHHHHHHCCHHH | 64.03 | 22902405 | |
| 67 | Acetylation | KALKEKEKADWSSLS HHHHHHHHCCHHHCC | 63.81 | 22902405 | |
| 71 | Phosphorylation | EKEKADWSSLSRDEK HHHHCCHHHCCHHHC | 23.19 | 27097102 | |
| 72 | Phosphorylation | KEKADWSSLSRDEKV HHHCCHHHCCHHHCE | 26.55 | 27097102 | |
| 74 | Phosphorylation | KADWSSLSRDEKVQL HCCHHHCCHHHCEEE | 39.37 | 27097102 | |
| 78 | Acetylation | SSLSRDEKVQLYRIQ HHCCHHHCEEEEEEE | 39.30 | 22902405 | |
| 89 | Phosphorylation | YRIQFNESFAEMNKG EEEEECHHHHHHCCC | 30.75 | 27097102 | |
| 95 | Acetylation | ESFAEMNKGTNEWKT HHHHHHCCCCCHHHH | 66.84 | 22902405 | |
| 149 | Acetylation | TKRMLDMKVNPIQGF HHHHHCCCCCCCCCC | 38.23 | 22902405 | |
| 157 | Phosphorylation | VNPIQGFSAKWDYNK CCCCCCCCCCCCCCC | 35.45 | 22673903 | |
| 157 | O-linked_Glycosylation | VNPIQGFSAKWDYNK CCCCCCCCCCCCCCC | 35.45 | 27213235 | |
| 159 | Acetylation | PIQGFSAKWDYNKNE CCCCCCCCCCCCCCC | 39.12 | 22902405 | |
| 164 | Acetylation | SAKWDYNKNEWKK-- CCCCCCCCCCCCC-- | 50.44 | 22902405 | |
| 168 | Acetylation | DYNKNEWKK------ CCCCCCCCC------ | 42.29 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX41_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX41_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX41_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of COX41_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...