COX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COX2_MOUSE
• UniProt AC: P00405
• Protein Name: Cytochrome c oxidase subunit 2
• Gene Name: Mtco2
• Organism: Mus musculus (Mouse).
• Sequence Length: 227
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1..
• Protein Sequence: MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	QEVETIWTILPAVIL HHHHHHHHHHHHHHH	14.58	-
218	Phosphorylation	LEMVPLKYFENWSAS EEECCCHHHHCCCCC	24.65	27742792
223	Phosphorylation	LKYFENWSASMI--- CHHHHCCCCCCC---	23.27	30165576
225	Phosphorylation	YFENWSASMI----- HHHCCCCCCC-----	16.11	30165576

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COX2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COX2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COX2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of COX2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.