dbPTM

COX2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COX2_ARATH
UniProt AC	P93285
Protein Name	Cytochrome c oxidase subunit 2
Gene Name	COX2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	260
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity)..
Protein Sequence	MIVLKWLFFTISPCDAAEPWQLGFQDAATPIMQGIIDLHHDIFFFLILILVFVLWILVRALWHFHYKKNAIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEEDLELGQLRLLEVDNRVVVPAKTHLRIIVTSADVLHSWAVPSLGVKCDAVPGRLNQISILVQREGVYYGQCSEICGTNHAFMSIVVEAVSRKDYGSWVSNQLIPQTGEA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of COX2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COX2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COX2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COX2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COX2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COX2_ARATH

Related Literatures of Post-Translational Modification