COX19_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COX19_HUMAN
• UniProt AC: Q49B96
• Protein Name: Cytochrome c oxidase assembly protein COX19
• Gene Name: COX19
• Organism: Homo sapiens (Human).
• Sequence Length: 90
• Subcellular Localization: Cytoplasm, cytosol . Mitochondrion intermembrane space . Mitochondrion . Partitions between mitochondria and the cytosol in a copper-dependent manner. Enriched in the cytosol when intracellular copper concentrations are elevated.
• Protein Description: Required for the transduction of an SCO1-dependent redox signal from the mitochondrion to ATP7A to regulate cellular copper homeostasis. [PubMed: 23345593 May be required for the assembly of mitochondrial cytochrome c oxidase (By similarity]
• Protein Sequence: MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEAKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSTAMNFGT ------CCCCCCCCC	25.52	19413330
2	Phosphorylation	------MSTAMNFGT ------CCCCCCCCC	25.52	26270265
3	Phosphorylation	-----MSTAMNFGTK -----CCCCCCCCCC	28.73	26270265
9	Phosphorylation	STAMNFGTKSFQPRP CCCCCCCCCCCCCCC	21.27	26270265
55	Phosphorylation	NALCRKESKEYLECR HHHHHHHCHHHHHHH	33.55	29214152
58	Phosphorylation	CRKESKEYLECRMER HHHHCHHHHHHHHHH	16.13	26074081
66	Acetylation	LECRMERKLMLQEPL HHHHHHHHHHHHHHH	25.58	27452117
68	Sulfoxidation	CRMERKLMLQEPLEK HHHHHHHHHHHHHHH	3.99	21406390
85	Ubiquitination	FGDLTSGKSEAKK-- CCCCCCCCCHHCC--	44.91	29967540
90	Ubiquitination	SGKSEAKK------- CCCCHHCC-------	73.03	24816145

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COX19_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COX19_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COX19_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of COX19_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.