dbPTM

COX11_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COX11_MOUSE
UniProt AC	Q6P8I6
Protein Name	Cytochrome c oxidase assembly protein COX11, mitochondrial
Gene Name	Cox11
Organism	Mus musculus (Mouse).
Sequence Length	275
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein Intermembrane side .
Protein Description	Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I..
Protein Sequence	MGGLWCPGWRLVASCGRGWRQPGWSGRTVVNAELVLRPGWDGLGGAERGLRRLGTWKRPCGVRGPATQPPRRPRSSNPFQRAQEDEWRRRNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHSSDQIENMVPVKDRVIKVTFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYTFFEAKEGHKLPVPGYN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of COX11_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COX11_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COX11_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COX11_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COX11_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COX11_MOUSE

Related Literatures of Post-Translational Modification