dbPTM

COQ4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COQ4_MOUSE
UniProt AC	Q8BGB8
Protein Name	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial {ECO:0000255\|HAMAP-Rule:MF_03111}
Gene Name	Coq4
Organism	Mus musculus (Mouse).
Sequence Length	266
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side .
Protein Description	Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides..
Protein Sequence	MATLLLLRSLRLHRSLRPRTRPAVDVPLRAGSHGARLLYPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLDVNKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPIRLRTQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
107	Phosphorylation	LQERPRISLSTLDLS HHHCCCEEEECCCHH	19.97	28066266
109	Phosphorylation	ERPRISLSTLDLSKL HCCCEEEECCCHHHC	21.82	26824392
110	Phosphorylation	RPRISLSTLDLSKLQ CCCEEEECCCHHHCC	29.59	28833060
114	Phosphorylation	SLSTLDLSKLQSLPE EEECCCHHHCCCCCC	30.87	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COQ4_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COQ4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COQ4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COQ4_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COQ4_MOUSE

Related Literatures of Post-Translational Modification