UniProt ID | COQ4_MOUSE | |
---|---|---|
UniProt AC | Q8BGB8 | |
Protein Name | Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03111} | |
Gene Name | Coq4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 266 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
Protein Description | Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides.. | |
Protein Sequence | MATLLLLRSLRLHRSLRPRTRPAVDVPLRAGSHGARLLYPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLDVNKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPIRLRTQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
107 | Phosphorylation | LQERPRISLSTLDLS HHHCCCEEEECCCHH | 19.97 | 28066266 | |
109 | Phosphorylation | ERPRISLSTLDLSKL HCCCEEEECCCHHHC | 21.82 | 26824392 | |
110 | Phosphorylation | RPRISLSTLDLSKLQ CCCEEEECCCHHHCC | 29.59 | 28833060 | |
114 | Phosphorylation | SLSTLDLSKLQSLPE EEECCCHHHCCCCCC | 30.87 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COQ4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COQ4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COQ4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COQ4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...