UniProt ID | COPZ1_MOUSE | |
---|---|---|
UniProt AC | P61924 | |
Protein Name | Coatomer subunit zeta-1 | |
Gene Name | Copz1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 177 | |
Subcellular Localization |
Cytoplasm. Golgi apparatus membrane Peripheral membrane protein Cytoplasmic side. Cytoplasmic vesicle, COPI-coated vesicle membrane Peripheral membrane protein Cytoplasmic side. The coatomer is cytoplasmic or polymerized on the cytoplasmic side o |
|
Protein Description | The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).; The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex.. | |
Protein Sequence | MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEALILEP -------CCCEECCC | 6.49 | - | |
11 | Phosphorylation | LILEPSLYTVKAILI EECCCCCEEEEEEEE | 17.52 | 29899451 | |
12 | Phosphorylation | ILEPSLYTVKAILIL ECCCCCEEEEEEEEE | 22.33 | 29899451 | |
29 | Acetylation | DGDRLFAKYYDDTYP CCCCEEHHHCCCCCC | 36.69 | 22826441 | |
39 | Ubiquitination | DDTYPSVKEQKAFEK CCCCCCHHHHHHHHC | 59.78 | 22790023 | |
46 | Acetylation | KEQKAFEKNIFNKTH HHHHHHHCCCCCCCC | 49.22 | 23954790 | |
46 | Ubiquitination | KEQKAFEKNIFNKTH HHHHHHHCCCCCCCC | 49.22 | 22790023 | |
51 | Ubiquitination | FEKNIFNKTHRTDSE HHCCCCCCCCCCHHH | 34.65 | 22790023 | |
69 | Phosphorylation | LEGLTVVYKSSIDLY HCCCEEEEECCCEEE | 10.79 | 21454597 | |
161 | Phosphorylation | PLTEQTVSQVLQSAK CCCHHHHHHHHHHHH | 20.26 | 30352176 | |
166 | Phosphorylation | TVSQVLQSAKEQIKW HHHHHHHHHHHHHHH | 36.83 | 30352176 | |
168 | Ubiquitination | SQVLQSAKEQIKWSL HHHHHHHHHHHHHHH | 56.23 | 22790023 | |
172 | Ubiquitination | QSAKEQIKWSLLR-- HHHHHHHHHHHCC-- | 30.35 | 22790023 | |
174 | Phosphorylation | AKEQIKWSLLR---- HHHHHHHHHCC---- | 16.72 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COPZ1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COPZ1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COPZ1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COPZ1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...