UniProt ID | COPRS_MOUSE | |
---|---|---|
UniProt AC | Q9CQ13 | |
Protein Name | Coordinator of PRMT5 and differentiation stimulator | |
Gene Name | Coprs | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 173 | |
Subcellular Localization | Nucleus. | |
Protein Description | Histone-binding protein required for histone H4 methyltransferase activity of PRMT5. Specifically required for histone H4 'Arg-3' methylation mediated by PRMT5, but not histone H3 'Arg-8' methylation, suggesting that it modulates the substrate specificity of PRMT5. Specifically interacts with the N-terminus of histone H4 but not with histone H3, suggesting that it acts by promoting the association between histone H4 and PRMT5. Involved in CCNE1 promoter repression (By similarity). Plays a role in muscle cell differentiation by modulating the recruitment of PRMT5 to the promoter of genes involved in the coordination between cell cycle exit and muscle differentiation.. | |
Protein Sequence | MDPQAATGRGPGERSSQEAPSAEAGFATADLSGRETETELAVDRLASGAQSIPADIPAHAEGPSSEEEGFAVEKEADGELYAWELSEGPSCPPMEQAADLFNEDWDLELKADQGNPYDADDIQGSISQEIKPWVCCAPQGDMIYDPSWHHPPPLIPHYSKMVFETGQFDDAED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDPQAATG -------CCHHHHCC | - | ||
15 | Phosphorylation | GRGPGERSSQEAPSA CCCCCCCCCCCCCCC | 19060867 | ||
16 | Phosphorylation | RGPGERSSQEAPSAE CCCCCCCCCCCCCCC | 19060867 | ||
21 | Phosphorylation | RSSQEAPSAEAGFAT CCCCCCCCCCCCCEE | 25293948 | ||
51 | Phosphorylation | RLASGAQSIPADIPA HHHHCCCCCCCCCCC | 25338131 | ||
64 | Phosphorylation | PAHAEGPSSEEEGFA CCCCCCCCCHHCCEE | 27087446 | ||
65 | Phosphorylation | AHAEGPSSEEEGFAV CCCCCCCCHHCCEEE | 27087446 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COPRS_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COPRS_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COPRS_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COPRS_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...