UniProt ID | COMD3_MOUSE | |
---|---|---|
UniProt AC | Q63829 | |
Protein Name | COMM domain-containing protein 3 | |
Gene Name | Commd3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 195 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits.. | |
Protein Sequence | MELSESVQRGIQTLADPGSFDSNAFALLLRAAFQSLLDARADEAALDHPYLKQIDPVVLKHCHAAAATCILEAGKHQVDKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLETLLGSIGRSLPHITDVSWRLEYQIKTNQLHKMYRPGYLVTLNVENNDSQSYPEINFSCNMEQLQDLVGKLKDASKSLERATQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Ubiquitination | ALDHPYLKQIDPVVL HCCCHHHHCCCHHHH | 39.09 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COMD3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COMD3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COMD3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COMD3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...