COL10_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COL10_ARATH
• UniProt AC: Q9LUA9
• Protein Name: Zinc finger protein CONSTANS-LIKE 10
• Gene Name: COL10
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 373
• Subcellular Localization: Nucleus .
• Protein Sequence: MGYMCDFCGEQRSMVYCRSDAACLCLSCDRNVHSANALSKRHSRTLVCERCNAQPASVRCSDERVSLCQNCDWSGHDGKNSTTTSHHKRQTINCYSGCPSSAELSSIWSFCMDLNISSAEESACEQGMGLMTIDEDGTGEKSGVQKINVEQPETSSAAQGMDHSSVPENSSMAKELGVCEDDFNGNLISDEVDLALENYEELFGSAFNSSRYLFEHGGIGSLFEKDEAHEGSMQQPALSNNASADSFMTCRTEPIICYSSKPAHSNISFSGITGESNAGDFQDCGASSMKQLSREPQPWCHPTAQDIIASSHATTRNNAVMRYKEKKKARKFDKRVRYVSRKERADVRRRVKGRFVKSGEAYDYDPMSPTRSY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
364	Phosphorylation	KSGEAYDYDPMSPTR CCCCCCCCCCCCCCC	14.85	30407730
368	Phosphorylation	AYDYDPMSPTRSY-- CCCCCCCCCCCCC--	28.62	19880383
370	Phosphorylation	DYDPMSPTRSY---- CCCCCCCCCCC----	25.58	19880383
372	Phosphorylation	DPMSPTRSY------ CCCCCCCCC------	37.36	19880383
373	Phosphorylation	PMSPTRSY------- CCCCCCCC-------	21.20	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COL10_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COL10_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COL10_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of COL10_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.