UniProt ID | COA1_SCHPO | |
---|---|---|
UniProt AC | O14320 | |
Protein Name | Cytochrome c oxidase assembly factor 1 | |
Gene Name | coa1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 249 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein. |
|
Protein Description | Required for efficient assembly of cytochrome c oxidase in the mitochondrial inner membrane. Involved in a step coupling MSS51-dependent cotranslational insertion of COX1 to the addition of its heme A and copper B cofactors (By similarity).. | |
Protein Sequence | MISSKSLDYTRFLPFFAALVRGHCLTVKSPTHNCGSGVKTIMDKSSIFLKNRYPISINRFVQQRKTFCGASVCLHKVLVQRQFGFEEKSHGLKYKKLFRRNIGTSEKKNRLPDLLELSSSPRRLPILFAAFCLLWGTCAVLAIQYGKQNSNVTQVVMYRVQHSKEAQDLLGSNIDFKYPFPWVPGKLHKRQGFIDINFEVSGSLASGTVHYQSQRFGPIAHWVELDCTLTSNGKTIKIPTGVSKDTQWT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of COA1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COA1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...